PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 742aa    MW: 77948.4 Da    PI: 7.2049
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015843.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-095525891954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Aco015843.1 552 FEHflHPYPSDADKHFLARQTGLSRNQVSNWFINARVR 589
                  554459******************************88 PP

2BELL881.1e-284314832072
         BELL  20 dkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  + +Y++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdai+ q+
  Aco015843.1 431 KAKYNHYCEQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAISAQL 483
                  679***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.6E-52344481IPR006563POX domain
PfamPF075265.1E-38349480IPR006563POX domain
PROSITE profilePS5007112.471530593IPR001356Homeobox domain
SMARTSM003899.6E-10533597IPR001356Homeobox domain
CDDcd000862.73E-12533594No hitNo description
SuperFamilySSF466894.71E-17535600IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28536599IPR009057Homeodomain-like
PfamPF059202.2E-18550589IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MGIATPPPPP HLIIGLPKPV SSLQTPTTTS TSMSHGFHHH HHHHQGGIFG FSSDVFDRST  60
APSTTTTIPG NAGQHEHVAQ QSRREKLRVQ EFDPAGAAAT GHAQLVPIDD DTGDGDGEGG  120
GQEASMYATA AGGAGHAATG SMLSEMFNFA GGCPSGADFL GYRQLSAMRP AAPPMAAFGT  180
GDWYAGSSNK PQQQQQQQQA MHHHPALTAD SAMQLFLMNP PPPPPLLHRH QHTRSPSPPP  240
PPPPPPQPEQ HTQTLHHHQA LIQAFGDNSA ASFGGGQGLS LSLSSSLQQF EMAKAAEELR  300
VRDAAMLYYN QQQQQQQQLH HLQLEGHGQV LGPPQAAQLG FGPAGVAAVL RSSKYARAAQ  360
ELLEEFCSVG RGQFRSGRIG RGSAANNPNP KSGGNSGASS SAAAAAAAST SSSKEAPPLS  420
PAERFEQQRK KAKYNHYCEQ MQMVVNSFDS VMGFGAATPY TALAQKAMSR HFRCLKDAIS  480
AQLRQACELL GEKDAGGGSG LTKGETPRLR ILDQNLRQQR AFHHMGMMEQ EAWRPQRGLP  540
ERSVNVLRAW LFEHFLHPYP SDADKHFLAR QTGLSRNQVS NWFINARVRL WKPMVEEMYQ  600
QEAKDHDDDD EDDEAAAAAA AADAASSLSP PSSSGVGGAP PKSEPHPGGP PAPGPQNAPQ  660
APPQLSTSSA VADMAHAGLY SGRYAAAAAA THALRFGAAG DVSLTLGLRH GAAGSGGSGA  720
GVGGSDGGGG GRFGAVREFG G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16539596158Homeobox protein Meis1
4xrs_B1e-16539596158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008813264.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLF2CYW10.0F2CYW1_HORVD; Predicted protein
STRINGMLOC_58467.31e-176(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-120BEL1-like homeodomain 4